missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90818

Invitrogen™ Human DLC1 (aa 8-133) Control Fragment Recombinant Protein

Catalog No. RP90818
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90818 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90818 Supplier Invitrogen™ Supplier No. RP90818
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53635 (PA5-53635. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a GTPase-activating protein that is a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins. GAP family proteins participate in signaling pathways that regulate cell processes involved in cytoskeletal changes. This gene functions as a tumor suppressor gene in a number of common cancers, including prostate, lung, colorectal, and breast cancers. Multiple transcript variants due to alternative promoters and alternative splicing have been found for this gene.

Specifications

Accession Number Q96QB1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10395
Name Human DLC1 (aa 8-133) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A730069N07Rik; ARHGAP 7; ARHGAP7; deleted in liver cancer 1; deleted in liver cancer 1 protein; Deleted in liver cancer 1 protein homolog; deleted in liver cancer 1 variant 2; deleted in liver cancer variant 4; DLC 1; DLC1; Dlc-1; DLC1 Rho GTPase activating protein; DLC1 Rho GTPase activating protein; rho GTPase-activating protein 7; FLJ21120; HP; HP protein; KIAA1723; p122 RhoGAP; p122-RhoGAP; rho GTPase activating protein 7; rho GTPase-activating protein 7; RhoGAP; Rho-GTPase-activating protein 7; rho-type GTPase-activating protein 7; STARD 12; STARD12; StAR-related lipid; StAR-related lipid transfer (START) domain containing 12; stAR-related lipid transfer protein 12; START domain-containing protein 12; transfer protein 12; unm_sa1141
Common Name DLC1
Gene Symbol Dlc1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less