missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98378

Invitrogen™ Human DHRS11 (aa 100-178) Control Fragment Recombinant Protein

Catalog No. RP98378
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98378 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98378 Supplier Invitrogen™ Supplier No. RP98378

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59487. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DHRS11 gene ontology annotations related to this gene include oxidoreductase activity.

Specifications

Accession Number Q6UWP2
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 79154
Name Human DHRS11 (aa 100-178) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 17-beta-hydroxysteroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; ARPG836; dehydrogenase/reductase (SDR family) member 11; dehydrogenase/reductase 11; dehydrogenase/reductase SDR family member 11; DHRS11; Estradiol 17-beta-dehydrogenase; hypothetical protein LOC510264; inactive dehydrogenase/reductase isoform; LOW QUALITY PROTEIN: dehydrogenase/reductase SDR family member 11; RGD1307935; SDR24C1; short chain dehydrogenase/reductase family 24C, member 1; short-chain dehydrogenase/reductase family 24C member 1; spDHRS11; UNQ836/PRO1774
Common Name DHRS11
Gene Symbol DHRS11
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less