missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98894

Invitrogen™ Human DHDH (aa 12-99) Control Fragment Recombinant Protein

Catalog No. RP98894
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98894 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98894 Supplier Invitrogen™ Supplier No. RP98894
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60624 (PA5-60624. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.

Specifications

Accession Number Q9UQ10
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27294
Name Human DHDH (aa 12-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300018L09Rik; 2 DD; 3-deoxyglucosone reductase; AA591799; CAN2DD; ch211-203b17.3; DDH; DHDH; dhdh0.2; dhdh-like0.1.L; dihydrodiol dehydrogenase; dihydrodiol dehydrogenase (dimeric); dihydrodiol dehydrogenase, tandem duplicate 2; dimeric dihydrodiol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Hum2DD; putative LOC617564 protein; SUS2DD; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase L homeolog; XELAEV_18036112mg; Xld1; Xld-1; xylose dehydrogenase 1; zgc:101723
Common Name DHDH
Gene Symbol DHDH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less