missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108821

Invitrogen™ Human DEPP1 (aa 110-205) Control Fragment Recombinant Protein

Catalog No. RP108821
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108821 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108821 Supplier Invitrogen™ Supplier No. RP108821

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140063 (PA5-140063. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEPP, also named as FIG and C10orf10, is known to be differentially regulated in mouse tissues in response to hypoxia and oxidative stress.

Specifications

Accession Number Q9NTK1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11067
Name Human DEPP1 (aa 110-205) Control Fragment
Quantity 100 μL
Gene Alias C10orf10; chromosome 10 open reading frame 10; decidual protein induced by progesterone; DEPP; DEPP1; fasting induced; fasting-induced gene protein; fasting-induced protein; fat-specific expressed; FIG; Fseg; protein DEPP; Protein DEPP1
Common Name DEPP1
Gene Symbol DEPP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less