missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91621

Invitrogen™ Human DEPDC7 (aa 135-246) Control Fragment Recombinant Protein

Catalog No. RP91621
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91621 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91621 Supplier Invitrogen™ Supplier No. RP91621
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110808 (PA5-110808. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEPDC7 gene ontology annotations related to this gene include intracellular signal transduction; regulation of small GTPase mediated signal transduction.

Specifications

Accession Number Q96QD5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91614
Name Human DEPDC7 (aa 135-246) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AV216087; DEP domain containing 7; DEP domain-containing protein 7; Depdc7; dJ85M6.4; dJ85M6.4 (novel 58.3 KDA protein); novel 58.3 KDA protein; Protein TR2/D15; RGD1309720; TR2
Common Name DEPDC7
Gene Symbol DEPDC7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TTIPNQDSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less