missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP100832

Invitrogen™ Human DENND5A (aa 815-867) Control Fragment Recombinant Protein

Catalog No. RP100832
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100832 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100832 Supplier Invitrogen™ Supplier No. RP100832
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63049 (PA5-63049. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DENND5A (DENN domain-containing protein 5A) is a guanine nucleotide exchange factor (GEF) which activates RAB6A and RAB39A/RAB39B. It promotes the exchange of GDP to GTP by converting inactive GDP-bound Rab proteins to their active GTP form. DENND5A is also involved in the negative regulation of neurtie outgrowth. Mutations affecting this gene can result in epileptic encephalopathy, early infantile, 49 (EIEE49).

Specifications

Accession Number Q6IQ26
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23258
Name Human DENND5A (aa 815-867) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500012B19Rik; AJ245569; AW496491; DENN domain containing 5 A; DENN domain-containing protein 5 A; DENN/MADD domain containing 5 A; DENND5A; KIAA1091; mKIAA1091; ORF37; Rab6 interacting protein 1; rab6-interacting protein 1; RAB6IP1
Common Name DENND5A
Gene Symbol DENND5A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SALWSHLLHYQDNRQRKLTSGSLSTSGILLDSERRKSDASSLMPPLRISLIQD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less