missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105997

Invitrogen™ Human DDX18 (aa 46-107) Control Fragment Recombinant Protein

Catalog No. RP105997
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105997 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105997 Supplier Invitrogen™ Supplier No. RP105997

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65284 (PA5-65284. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP-dependent RNA helicase DDX18 belongs to theDEAD box helicase family, which contains one helicase ATP-binding domain and one helicase C-terminal domain. DDX18 is induced by Myc and Max and is involved in splicing and nuclear export. It is reported to be differentially expressed during viral latency and at early times after induction into active replication.

Specifications

Accession Number Q9NVP1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8886
Name Human DDX18 (aa 46-107) Control Fragment
Quantity 100 μL
Gene Alias ATP-dependent RNA helicase DDX18; cPERP-D; DDX18; DEAD (Asp-Glu-Ala-Asp) box polypeptide 18; DEAD box protein 18; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18 (Myc-regulated); DEAD-box helicase 18; MrDb; Myc-regulated DEAD box protein
Common Name DDX18
Gene Symbol DDX18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less