missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91022

Invitrogen™ Human DCHS1 (aa 3029-3178) Control Fragment Recombinant Protein

Catalog No. RP91022
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91022 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91022 Supplier Invitrogen™ Supplier No. RP91022

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53683 (PA5-53683. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q96JQ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8642
Name Human DCHS1 (aa 3029-3178) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cadherin-19; cadherin-25; cadherin-related family member 6; CDH19; CDH25; CDHR6; dachsous cadherin-related 1; DCHS1; FIB1; fibroblast cadherin 1; fibroblast cadherin FIB1; Fibroblast cadherin-1; KIAA1773; MVP2; PCDH16; Protein dachsous homolog 1; protocadherin-16; VMLDS1
Common Name DCHS1
Gene Symbol DCHS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSSGRGSAEAAEDDEIRMINEFPRVASVASSLAARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLGGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less