missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94930

Invitrogen™ Human DACT2 (aa 505-566) Control Fragment Recombinant Protein

Catalog No. RP94930
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94930 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94930 Supplier Invitrogen™ Supplier No. RP94930

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56414 (PA5-56414. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Wnt signaling cascade is a conserved process in multicellular animals that plays important roles during development and can contribute to cancer and other diseases. Many members of this pathway are also expressed in the postnatal tissues such as brain. One such protein is Dact2, a member of the Dact protein family that was initially identified through binding to Disheveled (Dvl), a cytoplasmic protein essential to Wnt signaling. Dact2 is most prominent during the development of the thymus kidneys, and salivary gland. Dact2 is thought to play a role distinct from that of Dact1 with Dact2 having a greater impact on a beta-catenin-independent process termed planar cell polarity/convergent-extension signaling. Furthermore, Dact2 but not Dact1 can inhibit Nodal signaling by promoting the endocytic degradation of TGF-beta receptors. At least two isoforms of Dact2 are known to exist.

Specifications

Accession Number Q5SW24
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 168002
Name Human DACT2 (aa 505-566) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900084M21Rik; A630024E20; bA503C24.7; C6orf116; Dact2; Dapper antagonist of catenin 2; dapper homolog 2; dapper homolog 2, antagonist of beta-catenin; dapper homolog 2, antagonist of beta-catenin (xenopus); dapper, antagonist of beta-catenin, homolog 2; DAPPER2; dishevelled binding antagonist of beta catenin 2; dishevelled-binding antagonist of beta-catenin 2; Dpr2; Frd2; mDpr2; PP13671; RP11-503C24.7
Common Name DACT2
Gene Symbol DACT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DKVLRFARQPLLLLDRPEGAHAAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less