missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CYP21A2 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100043
Description
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83939 (PA5-83939. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CYP21A2 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates steroids at the 21 position. Its activity is required for the synthesis of steroid hormones including cortisol and aldosterone. Mutations in CYP21A2 gene cause congenital adrenal hyperplasia.Specifications
| P08686 | |
| Blocking Assay, Control | |
| 1589 | |
| 100 μL | |
| 21-OHase; CA21H; CAH1; CPS1; CYP21; CYP21A2; CYP21B; Cytochrome P450 21; cytochrome P450 family 21 subfamily A member 2; cytochrome P450 XXI; cytochrome P450, family 21, subfamily A, polypeptide 2; cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenal hyperplasia), polypeptide 2; Cytochrome P-450c21; Cytochrome P450-C21; Cytochrome P450-C21B; P-450c21; P450-C21; P450c21B; P450-C21B; steroid 21 hydroxylase; steroid 21-hydroxylase; steroid 21-monooxygenase | |
| CYP21A2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CYP21A2 Control Fragment | |
| RUO | |
| CYP21A2 | |
| Unconjugated | |
| Recombinant | |
| GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |