missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Cyclin L2 (aa 39-84) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100477
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62738 (PA5-62738. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CCNL2 belongs to the cyclin family, Cyclin L subfamily. CCNL2 is a transcriptional regulator which participates in regulating the pre-mRNA splicing process. CCNL2 also modulates the expression of critical apoptotic factor, leading to cell apoptosis.Specifications
| Q96S94 | |
| Blocking Assay, Control | |
| 81669 | |
| 100 μL | |
| 1700010A01Rik; 1810019L15Rik; 2010319M22Rik; AA409936; Ania6b; ANIA-6 B; AW261738; Ccnl2; CCNM; CCNS; Cyclin Ania-6 b; cyclin L2; cyclin M; cyclin S; cyclin-L2; HCLA-150; HCLA-ISO; HLA-ISO; hypothetical protein LOC538796; MNCb-5160; paneth cell enhanced expression; paneth cell-enhanced expression protein; PCEE; SB138 | |
| CCNL2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Cyclin L2 (aa 39-84) Control Fragment | |
| RUO | |
| Cyclin L2 | |
| Unconjugated | |
| Recombinant | |
| DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |