missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Cyclin L1 (aa 338-391) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105087
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84358 (PA5-84358. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FUS/TLS was originally described as fused in Sarcoma is actually related to a number of different cellular processes and correlated to several diseases. FUS binds DNA as a single or double strand, and acts as a site for transcription factors to recognize. Since FUS is well-documented to be involved in liposarcoma, lipoma and leukaemia, it is believed that when its normal housekeeping functions related to transcription are disrupted, normal cells become cancerous. Interestingly, FUS is also associated with the fatal neuron disorder amyotrophic lateral sclerosis; interruption of its normal RNA-binding functions leads to incorrect cellular localization and leads to pathologies of the neuron. Thus, FUS regulation of cellular functions is a critical component of maintenance of healthy cells.Specifications
| Q9UK58 | |
| Blocking Assay, Control | |
| 57018 | |
| 100 μL | |
| 2610030E23Rik; ANIA6A; ania-6 A; AU018493; BM-001; Ccn1; Ccnl; CCNL1; Cyclin Ania-6 A; cyclin L ania-6 A; cyclin L gamma; cyclin L1; cyclin-L; Cyclin-L1; LOW QUALITY PROTEIN: cyclin-L1; PRO1073; UNQ530/PRO1073 | |
| Ccnl1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Cyclin L1 (aa 338-391) Control Fragment | |
| RUO | |
| Cyclin L1 | |
| Unconjugated | |
| Recombinant | |
| SKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |