missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Cyclin A1 (aa 17-124) Control Fragment Recombinant Protein

Catalog No. RP107025
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107025 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107025 Supplier Invitrogen™ Supplier No. RP107025

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111508 (PA5-111508. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclins are regulatory subunits of the cyclin-dependent kinases (cdk's). They are expressed temporally to control transition at different specific phases of the cell cycle. In mammalian somatic cells, cyclin A is required for S-phase and passage through G2-phase.

Specifications

Accession Number P78396
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8900
Name Human Cyclin A1 (aa 17-124) Control Fragment
Quantity 100 μL
Gene Alias CCNA1; CT146; cyclin A1; cyclin-A1; testicular tissue protein Li 34
Common Name Cyclin A1
Gene Symbol CCNA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less