missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105348

Invitrogen™ Human CSTF1 (aa 330-428) Control Fragment Recombinant Protein

Catalog No. RP105348
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105348 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105348 Supplier Invitrogen™ Supplier No. RP105348
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66737 (PA5-66737. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene.

Specifications

Accession Number Q05048
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1477
Name Human CSTF1 (aa 330-428) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700057K18Rik; AI788832; CF-1 50 kDa subunit; cleavage stimulation factor 50 kDa subunit; Cleavage stimulation factor subunit 1; cleavage stimulation factor, 3' pre-RNA, subunit 1; cleavage stimulation factor, 3' pre-RNA, subunit 1, 50 kD; cleavage stimulation factor, 3' pre-RNA, subunit 1, 50 kDa; CSTF 50 kDa subunit; Cstf1; CstF50; CstF-50; CstFp50
Common Name CSTF1
Gene Symbol CSTF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less