missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CST11 (aa 24-70) Control Fragment Recombinant Protein

Catalog No. RP98478
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98478 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98478 Supplier Invitrogen™ Supplier No. RP98478
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62783 (PA5-62783. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes an epididymal-specific protein shown to have antimicrobial activity against E. coli. Alternative splicing yields two variants encoding distinct isoforms. [provided by RefSeq, Sep 2014].

Specifications

Accession Number Q9H112
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 140880
Name Human CST11 (aa 24-70) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CST11; CST8L; CTES2; cystatin 11; cystatin-11; cystatin-related epididymal-specific protein; dJ322G13.6; SC13; SC13delta
Common Name CST11
Gene Symbol CST11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less