missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CRM1 (aa 935-1071) Control Fragment Recombinant Protein

Catalog No. RP91836
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91836 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91836 Supplier Invitrogen™ Supplier No. RP91836
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Exportin - 1 (XPO1) mediates the nuclear export of cellular proteins bearing a leucine-rich nuclear export signal (NES) and RNAs. In the nucleus, in association with RANBP3, XPO1 binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex is mediated through binding to nucleoproteins. Upon transit of a nuclear complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP cause release of the cargo from the export receptor. The directionality of the nuclear export is thought to be conferred by an asymmetric distribution of the GTP and GDP bound forms of Ran between the cytoplasm and nucleus.

Specifications

Accession Number O14980
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7514
Name Human CRM1 (aa 935-1071) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA420417; chromosome region maintenance 1 homolog; chromosome region maintenance 1 protein homolog; CRM1; emb; Exp1; exportin 1; exportin 1 (CRM1 homolog, yeast); exportin 1 (CRM1, yeast, homolog); exportin 1, CRM1 homolog; exportin 1, CRM1 homolog (yeast); exportin-1; exportin-1 (required for chromosome region maintenance); Xpo1
Common Name CRM1
Gene Symbol XPO1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less