missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97388

Invitrogen™ Human CPSF7 (aa 42-120) Control Fragment Recombinant Protein

Catalog No. RP97388
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97388 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97388 Supplier Invitrogen™ Supplier No. RP97388

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FLJ12529 is a protein coding gene.

Specifications

Accession Number Q8N684
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 79869
Name Human CPSF7 (aa 42-120) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 5730453I16Rik; AL022757; C330017N18Rik; CFIm59; cleavage and polyadenylation specific factor 7; cleavage and polyadenylation specific factor 7, 59kDa; cleavage and polyadenylation specificity factor 59 kDa subunit; Cleavage and polyadenylation specificity factor subunit 7; cleavage factor Im complex 59 kDa subunit; CPSF 59 kDa subunit; Cpsf7; FLJ12529; LOW QUALITY PROTEIN: cleavage and polyadenylation specificity factor subunit 7; pre mRNA cleavage factor I, 59 kDa subunit; pre-mRNA cleavage factor I, 59 kDa subunit; pre-mRNA cleavage factor Im 59 kDa subunit; RGD1305441; Unknown (protein for IMAGE:7949905)
Common Name CPSF7
Gene Symbol CPSF7
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less