missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CPN2 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100442
Description
Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52094 (PA5-52094. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CPN2, the 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.Specifications
| P22792 | |
| Blocking Assay, Control | |
| 1370 | |
| 100 μL | |
| 1300018K11Rik; ACBP; arginine carboxypeptidase; carboxypeptidase N 83 kDa chain; Carboxypeptidase N large subunit; Carboxypeptidase N polypeptide 2; Carboxypeptidase N regulatory subunit; carboxypeptidase N subunit 2; carboxypeptidase N, polypeptide 2; carboxypeptidase N, polypeptide 2 homolog; carboxypeptidase N, polypeptide 2, 83 kD; CPN reg; Cpn2; CPNreg; CPN-reg; RGD1305170 | |
| CPN2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CPN2 Control Fragment | |
| RUO | |
| CPN2 | |
| Unconjugated | |
| Recombinant | |
| FDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSNPEGTVVLACDQAQCRWLNVQLSPWQGSLGLQYNASQEW | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |