missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106550

Invitrogen™ Human CPI-17 (aa 95-136) Control Fragment Recombinant Protein

Catalog No. RP106550
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106550 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106550 Supplier Invitrogen™ Supplier No. RP106550

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84206 (PA5-84206. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CPI-17 is a phosphorylation-dependent inhibitory protein for smooth muscle myosin phosphate. CPI-17 was originally identified as a PKC-potentiated inhibitory protein of protein phosphatase-1, which is dominantly expressed in smooth muscle. Phosphorylation at Threonine 38, in vitro, by PKC or Rho-kinase enhances the inhibitory potency toward myosin phosphatase. CPI-17 is also phosphorylated at Threonine 38 by protein kinase N and might be involved in the calcium sensitization of smooth muscle contraction as a downstream effector of Rho and/or arachidonic acid. CPI-17 is dually phosphorylated at Serine 12 and Threonine 38 by a MYPT-associated kinase, M110 kinase.

Specifications

Accession Number Q96A00
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 94274
Name Human CPI-17 (aa 95-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110001M11Rik; 17 kDa PKC-potentiated inhibitory protein of PP1; 17-kDa PKC-potentiated inhibitory protein of PP1; 17-KDa protein; Cpi; CPI17; CPI-17; PKC-potentiated inhibitory protein of PP1; PPP1INL; PPP1R14A; Protein kinase C-potentiated inhibitor protein of 17 kDa; protein phosphatase 1 regulatory inhibitor subunit 14 A; protein phosphatase 1 regulatory subunit 14 A; protein phosphatase 1, regulatory (inhibitor) subunit 14 A
Common Name CPI-17
Gene Symbol PPP1R14A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less