missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105986

Invitrogen™ Human CPEB1 (aa 16-96) Control Fragment Recombinant Protein

Catalog No. RP105986
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105986 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105986 Supplier Invitrogen™ Supplier No. RP105986

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the nuclear membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the nuclear membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Specifications

Accession Number Q9BZB8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64506
Name Human CPEB1 (aa 16-96) Control Fragment
Quantity 100 μL
Gene Alias AU024112; CEBP; Cpeb; CPEB1; CPEB-1; CPE-binding protein 1; CPE-BP1; cytoplasmic polyadenylation element binding protein 1; cytoplasmic polyadenylation element-binding protein 1; FLJ13203; h-CEBP; h-CPEB; hCPEB-1; mCPEB; mCPEB-1; MGC34136; MGC60106
Common Name CPEB1
Gene Symbol CPEB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less