missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101915

Invitrogen™ Human COX6B1 (aa 3-83) Control Fragment Recombinant Protein

Catalog No. RP101915
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101915 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101915 Supplier Invitrogen™ Supplier No. RP101915
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52070 (PA5-52070. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Connects the two COX monomers into the physiological dimeric form.

Specifications

Accession Number P14854
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1340
Name Human COX6B1 (aa 3-83) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010000G05Rik; COX VIb-1; Cox6b; COX6B1; COXG; COXVIb1; cytochrome c oxidase subunit 6B1; cytochrome c oxidase subunit VIb; Cytochrome c oxidase subunit VIb isoform 1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); cytochrome c oxidase, subunit VIb polypeptide 1; LOC688869; similar to cytochrome c oxidase, subunit VIb polypeptide 1
Common Name COX6B1
Gene Symbol COX6B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less