missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88736

Invitrogen™ Human COTL1 (aa 25-120) Control Fragment Recombinant Protein

Catalog No. RP88736
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88736 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88736 Supplier Invitrogen™ Supplier No. RP88736

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52628 (PA5-52628. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes.

Specifications

Accession Number Q14019
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23406
Name Human COTL1 (aa 25-120) Control Fragment
Quantity 100 μL
Gene Alias 1810074P22Rik; 2010004C08Rik; CLP; coactosin like F-actin binding protein 1; coactosin-like 1; coactosin-like 1 (Dictyostelium); coactosin-like F-actin binding protein 1; coactosin-like protein; coactosin-like protein {ECO:0000250; Cotl1; cotl1 {ECO:0000312; EMBL:AAI58747.1, ECO:0000312; FLJ43657; MGC137989 protein; MGC19733; RGD:1305498}; UniProtKB:Q14019}; Unknown (protein for MGC:63983); wu:fb08h08; zgc:63983
Common Name COTL1
Gene Symbol Cotl1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less