missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Complement C9 (aa 380-525) Control Fragment Recombinant Protein

Catalog No. RP95394
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95394 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95394 Supplier Invitrogen™ Supplier No. RP95394
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C5b-9 membrane attack complexes are assembled from five precursor molecules in the serum. Proteolytic cleavage of C5 by C5 convertase generates C5b which initiates assembly of the C5b-9 complex. The last step of C5b-9 complex formation involves polymerization of C9 which accompanies insertion of the complex into the cell membrane. During formation of C5b-8 and C9 polymerization, neoantigens are generated which are unique to the C5b-9 complex and are not present on any of the individual native complex components. The complement regulatory proteins CD59 and complement S-protein can both prevent C5b-9 insertion into the cell membrane. The formed SC5b-9 complex is unable to attach to cells and is cytolytically inactive. C5b-9 is involved in the progression of chronic proteinuric renal disease by mediating continuous tubulointerstitial damage. Early tubulointerstitial injury in the remnant kidney can be improved when C5b-9 complex forming is abrogated.

Specifications

Accession Number P02748
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 735
Name Human Complement C9 (aa 380-525) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARMD15; C9; C9D; complement C9; complement component 9; complement component C9; Complement component C9a; Complement component C9b; complement protein C9; complement protein C9 precursor
Common Name Complement C9
Gene Symbol C9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less