missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99259

Invitrogen™ Human COMMD5 (aa 108-155) Control Fragment Recombinant Protein

Catalog No. RP99259
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99259 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99259 Supplier Invitrogen™ Supplier No. RP99259
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83847 (PA5-83847. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COMMD5 is a protein coding gene. May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis. Down-regulates activation of NF-kappa-B.

Specifications

Accession Number Q9GZQ3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 28991
Name Human COMMD5 (aa 108-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310065H03Rik; AI854466; COMM domain containing 5; COMM domain-containing protein 5; COMMD5; D15Ertd81e; FLJ13008; HCARG; HT002; hypertension-related calcium regulated; hypertension-related calcium-regulated gene protein; hypertension-related, calcium regulated
Common Name COMMD5
Gene Symbol COMMD5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less