missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98343

Invitrogen™ Human COL9A3 (aa 504-556) Control Fragment Recombinant Protein

Catalog No. RP98343
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98343 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98343 Supplier Invitrogen™ Supplier No. RP98343

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59075 (PA5-59075. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. [provided by RefSeq, Jan 2010].

Specifications

Accession Number Q14050
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1299
Name Human COL9A3 (aa 504-556) Control Fragment
Quantity 100 μL
Gene Alias alpha 3 type IX collagen; AV006866; cb367; CO9A3; COL9A3; Collagen alpha-3(IX) chain; collagen IX, alpha-3 polypeptide; collagen type IX alpha 3; collagen type IX alpha 3 chain; collagen type IX proteoglycan; collagen, type IX, alpha 3; DJ885L7.4.1; EDM3; IDD; MED; procollagen, type IX, alpha 3; sb:cb367; si:ch73-162j3.1; wu:fa04f01
Common Name COL9A3
Gene Symbol COL9A3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less