missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102476

Invitrogen™ Human CNOT4 (aa 331-476) Control Fragment Recombinant Protein

Catalog No. RP102476
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102476 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102476 Supplier Invitrogen™ Supplier No. RP102476
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82214 (PA5-82214. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CNOT4 is a 575 amino acid protein with E3 ubiquitin ligase activity, mainly involved in protein modification and protein ubiquitination. It contains a ring type zinc finger domain of the C4C4 type, an RNA recognition motif and a bipartite nuclear localization signal.Studies show that CNOT4 is a component of the CCR4-NOT (CAF1) core complex that functions as general transcription regulation complex and has both a positive as well as a negative effect on the transcription of multiple functionally unrelated genes, thus controls gene expression. CNOT4 interacts with CNOT1 via C-terminus and with E2 ubiquitin ligases via C4C4 RING domain. Reports suggest that CNOT4 gets phosphorylated in response to DNA damage on consensus sites recognized by ATM and ATR.

Specifications

Accession Number O95628
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4850
Name Human CNOT4 (aa 331-476) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CCR4-associated factor 4; CCR4-NOT transcription complex subunit 4; CCR4-NOT transcription complex subunit 4 L homeolog; CCR4-NOT transcription complex subunit 4 S homeolog; CCR4-NOT transcription complex subunit 4 S homeolog; CCR4-NOT transcription complex, subunit 4; CCR4-NOT transcription complex, subunit 4 isoform a; CLONE243; cnot4; cnot4.S; E3 ubiquitin-protein ligase CNOT4; hypothetical protein; negative regulator of transcription 4; Not4; NOT4 (negative regulator of transcription 4, yeast) homolog; Not4h; Not4hp; Potential transcriptional repressor NOT4Hp; RING-type E3 ubiquitin transferase CNOT4; transcriptional repressor NOT4Hp; XELAEV_18019807mg
Common Name CNOT4
Gene Symbol CNOT4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less