missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93266

Invitrogen™ Human CLUH (aa 1147-1259) Control Fragment Recombinant Protein

Catalog No. RP93266
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93266 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93266 Supplier Invitrogen™ Supplier No. RP93266

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60682 (PA5-60682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

mRNA-binding protein involved in proper cytoplasmic distribution of mitochondria. Specifically binds mRNAs of nuclear-encoded mitochondrial proteins in the cytoplasm and regulates transport or translation of these transcripts close to mitochondria, playing a role in mitochondrial biogenesis.

Specifications

Accession Number O75153
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23277
Name Human CLUH (aa 1147-1259) Control Fragment
Quantity 100 μL
Gene Alias 1300001I01Rik; cb498; CG8443-like; CLU1; cluh; cluha; clustered mitochondria (cluA/CLU1) homolog; clustered mitochondria (cluA/CLU1) homolog a; clustered mitochondria homolog; clustered mitochondria protein homolog; KIAA0664; LOW QUALITY PROTEIN: clustered mitochondria protein homolog; mKIAA0664; RGD1307222; sb:cb498; Unknown (protein for IMAGE:6905374); wu:fb77e08; wu:fd36f07; wu:fe05g06; wu:fi27b10; zgc:152873
Common Name CLUH
Gene Symbol CLUH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSHHLVARVYESKAEFRSALQHEKEGYTIYKTQLGEDHEKTKESSEYLKCLTQQAVALQRTMNEIYRNGSSANIPPLKFTAPSMASVLEQLNVINGILFIPLSQKDLENLKAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less