missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93010

Invitrogen™ Human CIZ1 (aa 477-553) Control Fragment Recombinant Protein

Catalog No. RP93010
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93010 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93010 Supplier Invitrogen™ Supplier No. RP93010

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54193 (PA5-54193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May regulate the subcellular localization of CIP/WAF1.

Specifications

Accession Number Q9ULV3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25792
Name Human CIZ1 (aa 477-553) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610038H21Rik; 2900056O04Rik; CDKN1A interacting zinc finger protein 1; CDKN1A-interacting zinc finger protein 1; Cip1-interacting zinc finger protein; CIZ1; LSFR1; NP94; nuclear protein NP94; Zinc finger protein 356; ZNF356
Common Name CIZ1
Gene Symbol CIZ1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less