missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CIC (aa 1410-1521) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP102474
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83721 (PA5-83721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a core component of the exosome. The mammalian exosome is required for rapid degradation of AU rich element-containing RNAs but not for poly(A) shortening. The association of this protein with the exosome is mediated by protein-protein interactions with ribosomal RNA-processing protein 42 and ribosomal RNA-processing protein 46.Specifications
| Q96RK0 | |
| Blocking Assay, Control | |
| 23152 | |
| 100 μL | |
| 1200010B10Rik; Capicua; capicua homolog; capicua homolog (Drosophila); capicua transcriptional repressor; CIC; KIAA0306; mKIAA0306; Protein capicua homolog; protein capicua homolog; LOW QUALITY PROTEIN: protein capicua homolog | |
| CIC | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CIC (aa 1410-1521) Control Fragment | |
| RUO | |
| CIC | |
| Unconjugated | |
| Recombinant | |
| PKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTEAEDVLGELEYDKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |