missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CHSY3 (aa 654-724) Control Fragment Recombinant Protein

Catalog No. RP96969
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96969 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96969 Supplier Invitrogen™ Supplier No. RP96969
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60777 (PA5-60777. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity. Transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin polymer. Specific activity is much reduced compared to CHSY1.

Specifications

Accession Number Q70JA7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 337876
Name Human CHSY3 (aa 654-724) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833446K15Rik; AI662215; carbohydrate synthase 2; Chondroitin glucuronyltransferase 3; chondroitin sulfate synthase 3; Chondroitin synthase 2; chondroitin synthase-2; Chsy2; chSy-2; Chsy3; Css3; Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II; Kiaa4168; N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3; N-acetylgalactosaminyltransferase 3; RGD1560819
Common Name CHSY3
Gene Symbol CHSY3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less