missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90506

Invitrogen™ Human CHST2 (aa 390-523) Control Fragment Recombinant Protein

Catalog No. RP90506
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90506 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90506 Supplier Invitrogen™ Supplier No. RP90506

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64950 (PA5-64950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate.

Specifications

Accession Number Q9Y4C5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9435
Name Human CHST2 (aa 390-523) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI428561; AW121776; C130041E03Rik; C6ST; carbohydrate (chondroitin 6/keratan) sulfotransferase 2; carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; carbohydrate sulfotransferase 2; Chst2; Chts2; epididymis secretory protein Li 75; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GlcNAc6ST; glcNAc6ST-1; GN6ST; Gn6ST-1; GST2; GST-2; HEL-S-75; N-acetylglucosamine 6-O-sulfotransferase 1; N-acetylglucosamine-6-O-sulfotransferase
Common Name CHST2
Gene Symbol CHST2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less