missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101721

Invitrogen™ Human CHMP5 (aa 118-168) Control Fragment Recombinant Protein

Catalog No. RP101721
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101721 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101721 Supplier Invitrogen™ Supplier No. RP101721

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63303 (PA5-63303. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein family. These proteins are components of ESCRT-III, a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies. Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.

Specifications

Accession Number Q9NZZ3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51510
Name Human CHMP5 (aa 118-168) Control Fragment
Quantity 100 μL
Gene Alias 2210412K09Rik; apoptosis-related protein PNAS-2; AW545668; C9orf83; CGI-34; Charged multivesicular body protein 5; CHMP5; chromatin modifying protein 5; chromatin-modifying protein 5; HGNC:26942; HSPC177; hVps60; likely ortholog of H. sapiens SNF7 domain containing 2; PNAS-114; PNAS-2; SNF7 domain containing 2; SNF7 domain-containing protein 2; SNF7DC2; Vacuolar protein sorting-associated protein 60; Vps60
Common Name CHMP5
Gene Symbol CHMP5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less