missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104187

Invitrogen™ Human CHMP4B Control Fragment Recombinant Protein

Catalog No. RP104187
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104187 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104187 Supplier Invitrogen™ Supplier No. RP104187

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62471 (PA5-62471. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHMP4B is a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies.

Specifications

Accession Number Q9H444
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 128866
Name Human CHMP4B Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010012F05Rik; C20orf178; C76846; charged multivesicular body protein 4 b; CHMP4A; CHMP4B; chromatin modifying protein 4 B; chromatin-modifying protein 4 b; CTPP3; CTRCT31; dJ553F4.4; hSnf7-2; hVps32-2; RGD1309846; RGD1565889; Sha x 1; SNF7; SNF7 homolog associated with Alix 1; Snf7 homologue associated with Alix 1; Snf7-2; Vacuolar protein sorting-associated protein 32-2; vacuolar protein-sorting-associated protein 32-2; Vps32-2; VPS32B
Common Name CHMP4B
Gene Symbol CHMP4B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less