missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103713

Invitrogen™ Human CHD5 (aa 1574-1659) Control Fragment Recombinant Protein

Catalog No. RP103713
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103713 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103713 Supplier Invitrogen™ Supplier No. RP103713

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63133 (PA5-63133. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHD5 (Chromodomain helicase DNA binding protein 5) is a member of the SNF2/RAD54 helicase family of chromatin remodeling and DNA-binding proteins (CDH proteins). Heavily expressed in both fetal and adult brain, CHD5 plays a role in nervous system development and acts as a tumor suppressor via the Arf/p53 pathway. CHD5, along with other chromo-domain proteins, forms remodeling complexes, such as NuRD, that promote normal neuroblast maturation and are thought to prevent overexpression of neuronal cells. Errors in these chromatin remodeling complexes can leave the cell in a perpetual state of growth, preventing differentiation and leading to tumor formation. Due to the importance of the CHD proteins in proper brain development, deletions in the gene encoding CHD5 are commonly found in neuroblastomas, suggesting that CHD5 deficiency may lead to malignant cell transformation and metastasis.

Specifications

Accession Number Q8TDI0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26038
Name Human CHD5 (aa 1574-1659) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930532L22Rik; ATP-dependent helicase CHD5; AW060752; B230399N07Rik; CHD5; CHD-5; chromodomain helicase DNA binding protein 5; chromodomain-helicase-DNA-binding protein 5; KIAA0444
Common Name CHD5
Gene Symbol CHD5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less