missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94193

Invitrogen™ Human CHD1L (aa 561-663) Control Fragment Recombinant Protein

Catalog No. RP94193
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94193 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94193 Supplier Invitrogen™ Supplier No. RP94193
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55940 (PA5-55940. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In response to DNA strand breaks, chromatin adopts a relaxed structure due to the addition of poly(ADP-ribose) (PAR) to chromatin proteins by PARP enzymes (see PARP1; MIM 173870), and this relaxation facilitates the repair of DNA damage. CHD1L interacts with PAR and has a role in chromatin relaxation following DNA damage (Ahel et al., 2009 [PubMed 19661379]).

Specifications

Accession Number Q86WJ1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9557
Name Human CHD1L (aa 561-663) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4432404A22Rik; ALC1; amplified in liver cancer 1; amplified in liver cancer protein 1; CHD1L; CHDL; chromodomain helicase DNA binding protein 1 like; chromodomain helicase DNA binding protein 1-like; chromodomain-helicase-DNA-binding protein 1-like; LOW QUALITY PROTEIN: chromodomain-helicase-DNA-binding protein 1-like; Snf2p; Unknown (protein for MGC:128792)
Common Name CHD1L
Gene Symbol CHD1L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less