missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92682

Invitrogen™ Human CHCHD3 (aa 15-89) Control Fragment Recombinant Protein

Catalog No. RP92682
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92682 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92682 Supplier Invitrogen™ Supplier No. RP92682
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60167 (PA5-60167. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.

Specifications

Accession Number Q9NX63
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54927
Name Human CHCHD3 (aa 15-89) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610041L09Rik; 1700039J09Rik; AW558177; CHCHD3; coiled-coil-helix-coiled-coil-helix domain containing 3; Coiled-coil-helix-coiled-coil-helix domain-containing protein 3; coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial; FLJ20420; Mic19; MICOS complex subunit MIC19; MINOS3; mitochondrial inner membrane organizing system 3; PPP1R22; protein phosphatase 1, regulatory subunit 22
Common Name CHCHD3
Gene Symbol CHCHD3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less