missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CGREF1 (aa 21-153) Control Fragment Recombinant Protein

Catalog No. RP89919
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89919 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89919 Supplier Invitrogen™ Supplier No. RP89919

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52536 (PA5-52536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CGREF1 (cell growth regulator with EF-hand domain 1), also known as CGR11, is a 301 amino acid secreted protein that contains two highly conserved calcium binding EF-hand domains, which are required for mediating cell-cell adhesion. Induced by p53, CGREF1 is able to inhibit cell growth in various cell lines. CGREF1 is encoded by a gene located on human chromosome 2, which houses over 1,400 genes and comprises nearly 8% of the human genome. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene, while the lipid metabolic disorder sitosterolemia is associated with defects in the ABCG5 and ABCG8 genes. Additionally, an extremely rare recessive genetic disorder, Alstrom syndrome, is caused by mutations in the ALMS1 gene, which maps to chromosome 2.

Specifications

Accession Number Q99674
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10669
Name Human CGREF1 (aa 21-153) Control Fragment
Quantity 100 μL
Gene Alias 1110004G24Rik; AW045201; cell growth regulator with EF hand domain 1; cell growth regulator with EF hand domain protein 1; cell growth regulator with EF-hand domain 1; cell growth regulatory gene 11 protein; cell growth regulatory with EF-hand domain; CGR11; Cgref1; Hydrophobestin
Common Name CGREF1
Gene Symbol CGREF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRHVEPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less