missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CFAP97D1 (aa 1-81) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP103144
Description
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-62720 (PA5-62720, PA5-144729 (PA5-144729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CFAP97D1 is a protein that is encoded by the CFAP97D1 gene in humans. It is a component of the cilia and flagella, which are hair-like structures that protrude from the surface of cells and are involved in various cellular processes, including movement and signaling.Specifications
| B2RV13 | |
| Blocking Assay, Control | |
| 284067 | |
| 100 μL | |
| C17orf105; CFAP97 domain-containing protein 1; CFAP97D1; chromosome 17 open reading frame 105; uncharacterized protein C17orf105; Uncharacterized protein CFAP97D1 | |
| C17orf105 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CFAP97D1 (aa 1-81) Control Fragment | |
| RUO | |
| CFAP97D1 | |
| Unconjugated | |
| Recombinant | |
| MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYVSHKNRIQIAKPTVDTKPPVAHTNHILKLSKLQGEQKKINKIEYENKQL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |