missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89650

Invitrogen™ Human Centaurin alpha-1 (aa 36-140) Control Fragment Recombinant Protein

Catalog No. RP89650
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89650 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89650 Supplier Invitrogen™ Supplier No. RP89650
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52900 (PA5-52900. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Centaurin alpha-1 (ADAP1, ArfGAP With Dual PH Domains 1) is a Protein Coding gene. Among its related pathways are B Cell Receptor Signaling Pathway (sino) and Arf6 signaling events. Gene Ontology (GO) annotations related to this gene include GTPase activator activity and inositol 1,3,4,5 tetrakisphosphate binding. An important paralog of this gene is ADAP2.

Specifications

Accession Number O75689
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11033
Name Human Centaurin alpha-1 (aa 36-140) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930431P11Rik; ADAP1; Arf-GAP with dual PH domain-containing protein 1; ArfGAP with dual PH domains 1; CENTA1; centaurin, alpha 1; centaurin-alpha; centaurin-alpha-1; Cnt-a1; GC1L; GCS1L; inositol(1,3,4,5)tetrakisphosphate receptor; p42IP4; phosphatidylinositol-3,4,5-triphosphate binding protein; putative MAPK-activating protein PM25
Common Name Centaurin alpha-1
Gene Symbol ADAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less