missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CEBPZOS (aa 32-72) Control Fragment Recombinant Protein

Catalog No. RP99713
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99713 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99713 Supplier Invitrogen™ Supplier No. RP99713

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CEBPZOS is a protein coding gene. Gene ontology (GO) annotation include integral component of membrane; mitochondrial membrane.

Specifications

Accession Number A8MTT3
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 100505876
Name Human CEBPZOS (aa 32-72) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias CEBPZ antisense RNA 1; CEBPZ opposite strand; CEBPZ-AS1; CEBPZOS; Protein CEBPZOS
Common Name CEBPZOS
Gene Symbol CEBPZOS
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less