missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100001

Invitrogen™ Human CEACAM18 Control Fragment Recombinant Protein

Catalog No. RP100001
Change view
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Catalog No. Quantity
RP100001 100 μL
1 options

Catalog No. RP100001

Supplier: Invitrogen™ RP100001

Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63736 (PA5-63736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CEACAM18 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 18) is a Protein Coding gene. An important paralog of this gene is CEACAM5.

Specifications

Accession Number A8MTB9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 729767
Name Human CEACAM18 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias carcinoembryonic antigen related cell adhesion molecule 18; carcinoembryonic antigen-related cell adhesion molecule 18; CEACAM18
Common Name CEACAM18
Gene Symbol CEACAM18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less