missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99226

Invitrogen™ Human CEACAM16 (aa 322-412) Control Fragment Recombinant Protein

Catalog No. RP99226
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99226 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99226 Supplier Invitrogen™ Supplier No. RP99226
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60917 (PA5-60917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for proper hearing, it may play a role in maintaining the integrity of the tectorial membrane.

Specifications

Accession Number Q2WEN9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 388551
Name Human CEACAM16 (aa 322-412) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B-cell leukemia/lymphoma 3; Bcl3; carcinoembryonic antigen like-2 protein; carcinoembryonic antigen related cell adhesion molecule 16; Carcinoembryonic antigen-like 2; Carcinoembryonic antigen-related cell adhesion molecule 16; Ceacam16; CEAL2; CEA-related cell adhesion molecule 16; DFNA4B; Gm769
Common Name CEACAM16
Gene Symbol CEACAM16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less