Learn More
Invitrogen™ Human CDSN Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100042
Description
Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60804 (PA5-60804. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.- Environmental benefits include:
- Recyclable
Specifications
Q15517 | |
Blocking Assay, Control | |
1041 | |
100 ÎĽL | |
AI747712; CDSN; Corneodesmosin; D6S586E; differentiated keratinocyte S protein; HTSS; HTSS1; HYPT2; LOC682408; PSS; PSS1; S; S protein; similar to corneodesmosin | |
CDSN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CDSN Control Fragment | |
RUO | |
CDSN | |
Unconjugated | |
Recombinant | |
SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |