missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CDKL1 (aa 225-266) Control Fragment Recombinant Protein

Catalog No. RP101726
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101726 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101726 Supplier Invitrogen™ Supplier No. RP101726

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63754. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined.

Specifications

Accession Number Q00532
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8814
Name Human CDKL1 (aa 225-266) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4933411O17Rik; CDC2-related kinase 1; Cdkl1; cyclin dependent kinase like 1; cyclin-dependent kinase-like 1; cyclin-dependent kinase-like 1 (CDC2-related kinase); KKIALRE; P42; protein kinase p42 KKIALRE; serine/threonine protein kinase KKIALRE; serine/threonine-protein kinase KKIALRE; zgc:101002
Common Name CDKL1
Gene Symbol CDKL1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less