missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95420

Invitrogen™ Human CD99 (aa 143-183) Control Fragment Recombinant Protein

Catalog No. RP95420
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95420 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95420 Supplier Invitrogen™ Supplier No. RP95420
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111060 (PA5-111060. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD99 (E2, MIC2) is a transmembrane glycoprotein that is involved in regulation of T cell addhesive properties and programmed cell death distinct from typical apoptosis course. CD99 roles are specific to certain stages of T cell differentiation such as corticothymocytes. CD99R isoform expression is restricted in the haematopoietic system to T, NK and myeloid cells.

Specifications

Accession Number P14209
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4267
Name Human CD99 (aa 143-183) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110061M03Rik; 12E7; 2410026K10Rik; antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; Cd99; CD99 antigen; CD99 molecule; cell surface antigen 12E7; cell surface antigen HBA-71; cell surface antigen O13; D4; E2 antigen; HBA71; MIC2; MIC2 (monoclonal antibody 12E7); MIC2X; MIC2Y; MSK5X; paired immunoglobin-like type 2 receptor-ligand; pilr-1; Pilrl; PILR-L; Protein MIC2; surface antigen MIC2; T-cell surface glycoprotein E2
Common Name CD99
Gene Symbol CD99
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less