missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104135

Invitrogen™ Human CD84 Control Fragment Recombinant Protein

Catalog No. RP104135
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104135 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104135 Supplier Invitrogen™ Supplier No. RP104135

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD84 is expressed on mature B cells and on B cell lines, including pre B cell lines, but not on plasma cell lines. Immunohistochemical studies demonstrated that CD84 strongly expressed on tissues macrophages. CD84 is also highly expressed on platelets and, at low levels on peripheral blood T cells. It is a highly glycosylated protein and belongs to immunoglobulin superfamily. It may play a role in leukocyte activation.

Specifications

Accession Number Q9UIB8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8832
Name Human CD84 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A130013D22Rik; CD84; CD84 antigen; CD84 antigen (leukocyte antigen); CD84 molecule; CDw84; cell surface antigen MAX0.3; DKFZp781E2378; hCD84; Hly9-beta; leucocyte differentiation antigen CD84; leukocyte antigen CD84; leukocyte differentiation antigen CD84; LY9B; mCD84; RGD1564553; Signaling lymphocytic activation molecule 5; SLAM family member 5; SLAMF5
Common Name CD84
Gene Symbol CD84
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less