missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD61 (aa 385-490) Control Fragment Recombinant Protein

Catalog No. RP88614
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88614 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88614 Supplier Invitrogen™ Supplier No. RP88614

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD61, also known as GPIIIa or ITGB3, is a 105 kDa glycoprotein expressed on activated T cells, granulocytes, megakaryocytes, platelets, and their precursors. It plays a crucial role in platelet aggregation and functions as a receptor for fibrinogen, fibronectin, von Willebrand factor, vitronectin, and thrombospondin. CD61 forms heterodimeric complexes by associating non-covalently with integrin alpha subunits: alphaV (CD51) to create the Vitronectin Receptor and alphaIIb (CD41) to form gpIIb/IIIa. These complexes are responsible for adhesion to extracellular matrix components, facilitating cell adhesion and cell-surface mediated signaling. CD61 is expressed on platelets and megakaryocytes in association with CD41, and on endothelial cells, monocytes, and osteoclasts in association with CD51. The protein product of CD61 is composed of an alpha chain and a beta chain, which can combine with multiple partners to form different integrins. Its involvement in cell adhesion and signaling underscores its importance in normal physiological processes. Dysfunction of CD61 is associated with diseases such as Glanzmann Thrombasthenia and Platelet type-16 Bleeding Disorder, highlighting its critical role in hemostasis and platelet function.

Specifications

Accession Number P05106
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3690
Name Human CD61 (aa 385-490) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias antigen CD61; BDPLT16; BDPLT2; beta3 integrin; CD61; EGK_08849; glycoprotein GPIIIa; glycoprotein IIIa; GP3A; GPIIIa; GT; INGRB3; integrin beta 3; integrin beta 3 (Cd61); integrin beta-3; integrin beta-3 subunit; integrin subunit beta 3; integrin, beta 3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); ITGB3; platelet glycoprotein IIIa; platelet glycoprotein IIIa integrin subunit beta 3; platelet gpIIIa; platelet membrane glycoprotein IIIa
Common Name CD61 (Integrin beta 3)
Gene Symbol ITGB3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less