missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD300a Control Fragment Recombinant Protein

Catalog No. RP90441
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90441 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90441 Supplier Invitrogen™ Supplier No. RP90441
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139739 (PA5-139739, PA5-82434 (PA5-82434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CMRF35 antigen (CMRF35A; MIM 606786), which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes. CMRF35H is recognized by the same antibody and is distinct from CMRF35 (Green et al., 1998 [PubMed 9701027]).

Specifications

Accession Number Q9UGN4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11314
Name Human CD300a Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B230315M08Rik; CD300 antigen-like family member A; Cd300a; CD300a antigen; CD300a molecule; Clm8; CLM-8; CMRF35H; CMRF-35 H; CMRF35-H; CMRF35H leukocyte immunoglobulin-like receptor; CMRF35H9; CMRF-35-H9; CMRF35-H9; CMRF35HIRp60; CMRF35-like molecule 8; HSPC083; IGSF12; Immunoglobulin superfamily member 12; inhibitory receptor protein 60; IRC1; IRC1/IRC2; IRC2; IRp60; leukocyte membrane antigen; leukocyte mono-Ig-like receptor 1; Lmir1; MAIR-1; MAIR-I; MAIR-Ia; Mast cell-derived paired immunoglobulin-like receptor 1; Mcipr1; mcpir1; MMAC8; myeloid-associated immunoglobulin-like receptor 1; NK inhibitory receptor; NKRL; Pigr4; polymeric immunoglobulin receptor 4
Common Name CD300a
Gene Symbol CD300A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less