missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD3 (aa 151-207) Control Fragment Recombinant Protein

Catalog No. RP102954
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102954 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102954 Supplier Invitrogen™ Supplier No. RP102954

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CD3 subunit complex which is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules and this association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases. The genes encoding the CD3 epsilon, gamma and delta polypeptides are located on chromosome 11. Defects in the CD3 gene are associated with CD3 immunodeficiency.

Specifications

Accession Number P04234, P07766, P09693, P20963
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 915, 916, 917, 919
Name Human CD3 (aa 151-207) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Common Name CD3
Gene Symbol Cd247, Cd3d, CD3E, CD3g
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less