missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109068

Invitrogen™ Human CD155 (aa 130-209) Control Fragment Recombinant Protein

Catalog No. RP109068
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109068 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109068 Supplier Invitrogen™ Supplier No. RP109068
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number P15151
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5817
Name Human CD155 (aa 130-209) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3830421F03Rik; AI325026; AI987993; CD112; CD155; D7Ertd458e; FLJ25946; herpes virus entry mediator B; Herpesvirus entry mediator B; hveB; HVED; mE4; mHveB; Mph; murine herpes virus entry protein B; murine herpesvirus entry protein B; NECL5; necl-5; Nectin cell adhesion molecule 2; Nectin2; Nectin-2; nectin-like 5; nectin-like protein 5; Poliovirus receptor; poliovirus receptor homolog; poliovirus receptor-related 2; poliovirus receptor-related protein 2; poliovirus sensitivity; PVR; Pvrl2; PVS; sCD112; soluble CD112; Taa1; TAGE4; tumor-associated antigen 1; tumor-associated glycoprotein pE4
Common Name CD155
Gene Symbol PVR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less